Brand: | Abnova |
Reference: | H00339122-M01 |
Product name: | RAB43 monoclonal antibody (M01), clone 5G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB43. |
Clone: | 5G4 |
Isotype: | IgG2a Kappa |
Gene id: | 339122 |
Gene name: | RAB43 |
Gene alias: | ISY1|MGC90481|RAB11B|RAB41 |
Gene description: | RAB43, member RAS oncogene family |
Genbank accession: | NM_198490 |
Immunogen: | RAB43 (NP_940892, 113 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC |
Protein accession: | NP_940892 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RAB43 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |