RAB43 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RAB43 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB43 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about RAB43 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00339122-D01P
Product name: RAB43 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RAB43 protein.
Gene id: 339122
Gene name: RAB43
Gene alias: ISY1|MGC90481|RAB11B|RAB41
Gene description: RAB43, member RAS oncogene family
Genbank accession: NM_198490
Immunogen: RAB43 (NP_940892.1, 1 a.a. ~ 212 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC
Protein accession: NP_940892.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00339122-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RAB43 expression in transfected 293T cell line (H00339122-T02) by RAB43 MaxPab polyclonal antibody.

Lane 1: RAB43 transfected lysate(23.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB43 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart