RAB7B monoclonal antibody (M02A), clone 1C3 View larger

RAB7B monoclonal antibody (M02A), clone 1C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB7B monoclonal antibody (M02A), clone 1C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about RAB7B monoclonal antibody (M02A), clone 1C3

Brand: Abnova
Reference: H00338382-M02A
Product name: RAB7B monoclonal antibody (M02A), clone 1C3
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB7B.
Clone: 1C3
Isotype: IgG2a Kappa
Gene id: 338382
Gene name: RAB7B
Gene alias: MGC16212|MGC9726|RAB7
Gene description: RAB7B, member RAS oncogene family
Genbank accession: NM_177403
Immunogen: RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Protein accession: NP_796377
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00338382-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00338382-M02A-13-15-1.jpg
Application image note: Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M02A), clone 1C3.

Lane 1: RAB7B transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB7B monoclonal antibody (M02A), clone 1C3 now

Add to cart