Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00338382-M02A |
Product name: | RAB7B monoclonal antibody (M02A), clone 1C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB7B. |
Clone: | 1C3 |
Isotype: | IgG2a Kappa |
Gene id: | 338382 |
Gene name: | RAB7B |
Gene alias: | MGC16212|MGC9726|RAB7 |
Gene description: | RAB7B, member RAS oncogene family |
Genbank accession: | NM_177403 |
Immunogen: | RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
Protein accession: | NP_796377 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M02A), clone 1C3. Lane 1: RAB7B transfected lysate(22.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |