Brand: | Abnova |
Reference: | H00338382-M01 |
Product name: | RAB7B monoclonal antibody (M01), clone 3B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB7B. |
Clone: | 3B3 |
Isotype: | IgG2a Kappa |
Gene id: | 338382 |
Gene name: | RAB7B |
Gene alias: | MGC16212|MGC9726|RAB7 |
Gene description: | RAB7B, member RAS oncogene family |
Genbank accession: | NM_177403 |
Immunogen: | RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
Protein accession: | NP_796377 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration.Borg M, Bakke O, Progida C J Cell Sci. 2014 Nov 15;127(22):4927-39. doi: 10.1242/jcs.155861. Epub 2014 Sep 12. |