RAB7B monoclonal antibody (M01), clone 3B3 View larger

RAB7B monoclonal antibody (M01), clone 3B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB7B monoclonal antibody (M01), clone 3B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about RAB7B monoclonal antibody (M01), clone 3B3

Brand: Abnova
Reference: H00338382-M01
Product name: RAB7B monoclonal antibody (M01), clone 3B3
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB7B.
Clone: 3B3
Isotype: IgG2a Kappa
Gene id: 338382
Gene name: RAB7B
Gene alias: MGC16212|MGC9726|RAB7
Gene description: RAB7B, member RAS oncogene family
Genbank accession: NM_177403
Immunogen: RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Protein accession: NP_796377
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00338382-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00338382-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration.Borg M, Bakke O, Progida C
J Cell Sci. 2014 Nov 15;127(22):4927-39. doi: 10.1242/jcs.155861. Epub 2014 Sep 12.

Reviews

Buy RAB7B monoclonal antibody (M01), clone 3B3 now

Add to cart