Brand: | Abnova |
Reference: | H00338376-M02 |
Product name: | IFNE monoclonal antibody (M02), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNE. |
Clone: | 2F8 |
Isotype: | IgG2a Kappa |
Gene id: | 338376 |
Gene name: | IFNE |
Gene alias: | IFN-E|IFNE1|IFNT1|MGC119018|MGC119020|PRO655 |
Gene description: | interferon, epsilon |
Genbank accession: | NM_176891 |
Immunogen: | IFNE (NP_795372, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR |
Protein accession: | NP_795372 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |