IFNE1 monoclonal antibody (M01), clone 3B8 View larger

IFNE1 monoclonal antibody (M01), clone 3B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFNE1 monoclonal antibody (M01), clone 3B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re,IP

More info about IFNE1 monoclonal antibody (M01), clone 3B8

Brand: Abnova
Reference: H00338376-M01
Product name: IFNE1 monoclonal antibody (M01), clone 3B8
Product description: Mouse monoclonal antibody raised against a partial recombinant IFNE1.
Clone: 3B8
Isotype: IgG2a Kappa
Gene id: 338376
Gene name: IFNE
Gene alias: IFN-E|IFNE1|IFNT1|MGC119018|MGC119020|PRO655
Gene description: interferon, epsilon
Genbank accession: NM_176891
Immunogen: IFNE1 (NP_795372, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Protein accession: NP_795372
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00338376-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00338376-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IFNE1 is approximately 0.3ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy IFNE1 monoclonal antibody (M01), clone 3B8 now

Add to cart