IFNE MaxPab rabbit polyclonal antibody (D01) View larger

IFNE MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFNE MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about IFNE MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00338376-D01
Product name: IFNE MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human IFNE protein.
Gene id: 338376
Gene name: IFNE
Gene alias: IFN-E|IFNE1|IFNT1|MGC119018|MGC119020|PRO655
Gene description: interferon, epsilon
Genbank accession: NM_176891.3
Immunogen: IFNE (NP_795372.1, 1 a.a. ~ 208 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Protein accession: NP_795372.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00338376-D01-31-15-1.jpg
Application image note: Immunoprecipitation of IFNE transfected lysate using anti-IFNE MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IFNE MaxPab rabbit polyclonal antibody (D01) (H00338376-D01).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy IFNE MaxPab rabbit polyclonal antibody (D01) now

Add to cart