Cart 53 Product Products 15 554,05 € (empty)
No products
To be determined Shipping
15 554,05 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 53 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 554,05 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 554,05 €
Data sheet of CLEC4D purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CLEC4D purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00338339-B01P |
| Product name: | CLEC4D purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CLEC4D protein. |
| Gene id: | 338339 |
| Gene name: | CLEC4D |
| Gene alias: | CLEC-6|CLEC6|CLECSF8|MCL|MGC40078|MPCL |
| Gene description: | C-type lectin domain family 4, member D |
| Genbank accession: | NM_080387.4 |
| Immunogen: | CLEC4D (NP_525126.2, 1 a.a. ~ 215 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN |
| Protein accession: | NP_525126.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CLEC4D expression in transfected 293T cell line (H00338339-T01) by CLEC4D MaxPab polyclonal antibody. Lane 1: CLEC4D transfected lysate(23.65 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |