GPIHBP1 monoclonal antibody (M02), clone 1F9 View larger

GPIHBP1 monoclonal antibody (M02), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPIHBP1 monoclonal antibody (M02), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GPIHBP1 monoclonal antibody (M02), clone 1F9

Brand: Abnova
Reference: H00338328-M02
Product name: GPIHBP1 monoclonal antibody (M02), clone 1F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant GPIHBP1.
Clone: 1F9
Isotype: IgG1 Kappa
Gene id: 338328
Gene name: GPIHBP1
Gene alias: GPI-HBP1
Gene description: glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Genbank accession: NM_178172.2
Immunogen: GPIHBP1 (NP_835466.1, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Protein accession: NP_835466.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00338328-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00338328-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GPIHBP1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GPIHBP1 monoclonal antibody (M02), clone 1F9 now

Add to cart