EMR4P monoclonal antibody (M02), clone 1G10 View larger

EMR4P monoclonal antibody (M02), clone 1G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EMR4P monoclonal antibody (M02), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about EMR4P monoclonal antibody (M02), clone 1G10

Brand: Abnova
Reference: H00326342-M02
Product name: EMR4P monoclonal antibody (M02), clone 1G10
Product description: Mouse monoclonal antibody raised against a partial recombinant EMR4P.
Clone: 1G10
Isotype: IgG2a Kappa
Gene id: 326342
Gene name: EMR4P
Gene alias: EMR4|FIRE|GPR127|PGR16
Gene description: egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene
Genbank accession: XM_377506
Immunogen: EMR4P (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
Protein accession: XP_377506
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00326342-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00326342-M02-1-1-1.jpg
Application image note: EMR4P monoclonal antibody (M02), clone 1G10. Western Blot analysis of EMR4P expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EMR4P monoclonal antibody (M02), clone 1G10 now

Add to cart