SALF monoclonal antibody (M01), clone 5F12 View larger

SALF monoclonal antibody (M01), clone 5F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SALF monoclonal antibody (M01), clone 5F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about SALF monoclonal antibody (M01), clone 5F12

Brand: Abnova
Reference: H00286749-M01
Product name: SALF monoclonal antibody (M01), clone 5F12
Product description: Mouse monoclonal antibody raised against a partial recombinant SALF.
Clone: 5F12
Isotype: IgG2a Kappa
Gene id: 286749
Gene name: STON1-GTF2A1L
Gene alias: MGC126821|MGC126823|SALF
Gene description: STON1-GTF2A1L readthrough transcript
Genbank accession: NM_172311
Immunogen: SALF (NP_758515, 141 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS
Protein accession: NP_758515
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00286749-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00286749-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SALF is approximately 0.03ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SALF monoclonal antibody (M01), clone 5F12 now

Add to cart