Brand: | Abnova |
Reference: | H00286749-M01 |
Product name: | SALF monoclonal antibody (M01), clone 5F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SALF. |
Clone: | 5F12 |
Isotype: | IgG2a Kappa |
Gene id: | 286749 |
Gene name: | STON1-GTF2A1L |
Gene alias: | MGC126821|MGC126823|SALF |
Gene description: | STON1-GTF2A1L readthrough transcript |
Genbank accession: | NM_172311 |
Immunogen: | SALF (NP_758515, 141 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS |
Protein accession: | NP_758515 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SALF is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |