LCN12 MaxPab mouse polyclonal antibody (B01) View larger

LCN12 MaxPab mouse polyclonal antibody (B01)

H00286256-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LCN12 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LCN12 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00286256-B01
Product name: LCN12 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LCN12 protein.
Gene id: 286256
Gene name: LCN12
Gene alias: MGC34753|MGC48935
Gene description: lipocalin 12
Genbank accession: BC041168
Immunogen: LCN12 (AAH41168, 1 a.a. ~ 355 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGNMVHLQACWAVGTGPAGMSLVDPRGAGPSVYPGSSAPACAQGSPGSWVPVLNPGSEPPPAAPGPLSWATSSHPGSPVPGHLLPPQVPCPGPPPPAPPAPGPLSRPTSSHPGSPVLGYLLPPQVPCPGPSPPSGSPVLGHLLPSPIPAHKELGLIPGGALDLSSLPWVAAPA
Protein accession: AAH41168
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00286256-B01-13-15-1.jpg
Application image note: Western Blot analysis of LCN12 expression in transfected 293T cell line (H00286256-T01) by LCN12 MaxPab polyclonal antibody.

Lane 1: LCN12 transfected lysate(39.05 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LCN12 MaxPab mouse polyclonal antibody (B01) now

Add to cart