FBXO43 monoclonal antibody (M04), clone 4B6 View larger

FBXO43 monoclonal antibody (M04), clone 4B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO43 monoclonal antibody (M04), clone 4B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FBXO43 monoclonal antibody (M04), clone 4B6

Brand: Abnova
Reference: H00286151-M04
Product name: FBXO43 monoclonal antibody (M04), clone 4B6
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO43.
Clone: 4B6
Isotype: IgG2a Kappa
Gene id: 286151
Gene name: FBXO43
Gene alias: EMI2|ERP1|Fbx43
Gene description: F-box protein 43
Genbank accession: XM_209918
Immunogen: FBXO43 (XP_209918, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSQRHSGQAGTEAGNGADSPPIVNSKYSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLESPTQKKKCILPRKEKDKTPELCET
Protein accession: XP_209918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00286151-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00286151-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FBXO43 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO43 monoclonal antibody (M04), clone 4B6 now

Add to cart