RNF180 monoclonal antibody (M05), clone 1C4 View larger

RNF180 monoclonal antibody (M05), clone 1C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF180 monoclonal antibody (M05), clone 1C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about RNF180 monoclonal antibody (M05), clone 1C4

Brand: Abnova
Reference: H00285671-M05
Product name: RNF180 monoclonal antibody (M05), clone 1C4
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF180.
Clone: 1C4
Isotype: IgG2b Kappa
Gene id: 285671
Gene name: RNF180
Gene alias: MGC120326|MGC120328
Gene description: ring finger protein 180
Genbank accession: NM_178532
Immunogen: RNF180 (NP_848627, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVWHMNVEALPEWISCLIQKAQWTVGKLNCPFCGARLGGFNFV
Protein accession: NP_848627
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00285671-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00285671-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged RNF180 is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF180 monoclonal antibody (M05), clone 1C4 now

Add to cart