C5orf51 MaxPab mouse polyclonal antibody (B01) View larger

C5orf51 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C5orf51 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about C5orf51 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00285636-B01
Product name: C5orf51 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human C5orf51 protein.
Gene id: 285636
Gene name: C5orf51
Gene alias: -
Gene description: chromosome 5 open reading frame 51
Genbank accession: NM_175921
Immunogen: C5orf51 (NP_787117, 1 a.a. ~ 294 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
Protein accession: NP_787117
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00285636-B01-13-15-1.jpg
Application image note: Western Blot analysis of C5orf51 expression in transfected 293T cell line (H00285636-T01) by C5orf51 MaxPab polyclonal antibody.

Lane 1: C5orf51 transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C5orf51 MaxPab mouse polyclonal antibody (B01) now

Add to cart