Cart 77 Product Products 32 673,00 € (empty)
No products
To be determined Shipping
32 673,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 77 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 32 673,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 32 673,00 €
Data sheet of MGC34713 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MGC34713 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00285600-B01P |
| Product name: | MGC34713 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MGC34713 protein. |
| Gene id: | 285600 |
| Gene name: | C5orf36 |
| Gene alias: | DKFZp686F0372|MGC34713 |
| Gene description: | chromosome 5 open reading frame 36 |
| Genbank accession: | NM_173665 |
| Immunogen: | MGC34713 (NP_775936, 1 a.a. ~ 324 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDIDEKIEQNAASIKHCIKEIQSEINKQCPGVQLQTTTDCFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDLSCHSSVSFPSTLSGTSFHFLSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSKLQSHNEINNSQQKILLKKQCLQQLLFLYPESEVIIKYQNIQNKLLANLLWNCFPSYNRDSNLDVIAHGYQSTMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYLDTVTEEMAKFLENFCELQFRENAVRVVKTSKSSSKHRGAVHALG |
| Protein accession: | NP_775936 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MGC34713 expression in transfected 293T cell line by MGC34713 MaxPab polyclonal antibody. Lane 1: MGC34713 transfected lysate(35.64 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |