Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00285498-M01 |
Product name: | RNF212 monoclonal antibody (M01), clone 5H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF212. |
Clone: | 5H3 |
Isotype: | IgG2a Kappa |
Gene id: | 285498 |
Gene name: | RNF212 |
Gene alias: | FLJ38841|MGC120227|MGC120228|ZHP3 |
Gene description: | ring finger protein 212 |
Genbank accession: | NM_194439 |
Immunogen: | RNF212 (NP_919420, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMAPCARRVCHFQRFTMFLHRRLSSLAAPPSVQFWKARGTHQL |
Protein accession: | NP_919420 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody (M01), clone 5H3. Lane 1: RNF212 transfected lysate (Predicted MW: 33.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |