RNF212 monoclonal antibody (M01), clone 5H3 View larger

RNF212 monoclonal antibody (M01), clone 5H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF212 monoclonal antibody (M01), clone 5H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about RNF212 monoclonal antibody (M01), clone 5H3

Brand: Abnova
Reference: H00285498-M01
Product name: RNF212 monoclonal antibody (M01), clone 5H3
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF212.
Clone: 5H3
Isotype: IgG2a Kappa
Gene id: 285498
Gene name: RNF212
Gene alias: FLJ38841|MGC120227|MGC120228|ZHP3
Gene description: ring finger protein 212
Genbank accession: NM_194439
Immunogen: RNF212 (NP_919420, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMAPCARRVCHFQRFTMFLHRRLSSLAAPPSVQFWKARGTHQL
Protein accession: NP_919420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00285498-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00285498-M01-13-15-1.jpg
Application image note: Western Blot analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody (M01), clone 5H3.

Lane 1: RNF212 transfected lysate (Predicted MW: 33.4 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNF212 monoclonal antibody (M01), clone 5H3 now

Add to cart