LASS6 monoclonal antibody (M02), clone 6B8 View larger

LASS6 monoclonal antibody (M02), clone 6B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LASS6 monoclonal antibody (M02), clone 6B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about LASS6 monoclonal antibody (M02), clone 6B8

Brand: Abnova
Reference: H00253782-M02
Product name: LASS6 monoclonal antibody (M02), clone 6B8
Product description: Mouse monoclonal antibody raised against a partial recombinant LASS6.
Clone: 6B8
Isotype: IgG2b Kappa
Gene id: 253782
Gene name: LASS6
Gene alias: CerS6|MGC129949|MGC129950
Gene description: LAG1 homolog, ceramide synthase 6
Genbank accession: NM_203463
Immunogen: LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Protein accession: NP_982288
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00253782-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00253782-M02-1-6-1.jpg
Application image note: LASS6 monoclonal antibody (M02), clone 6B8 Western Blot analysis of LASS6 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LASS6 monoclonal antibody (M02), clone 6B8 now

Add to cart