LASS6 monoclonal antibody (M01), clone 5H7 View larger

LASS6 monoclonal antibody (M01), clone 5H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LASS6 monoclonal antibody (M01), clone 5H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about LASS6 monoclonal antibody (M01), clone 5H7

Brand: Abnova
Reference: H00253782-M01
Product name: LASS6 monoclonal antibody (M01), clone 5H7
Product description: Mouse monoclonal antibody raised against a partial recombinant LASS6.
Clone: 5H7
Isotype: IgG2a Kappa
Gene id: 253782
Gene name: LASS6
Gene alias: CerS6|MGC129949|MGC129950
Gene description: LAG1 homolog, ceramide synthase 6
Genbank accession: NM_203463
Immunogen: LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Protein accession: NP_982288
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00253782-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00253782-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: D,l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells.Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S.
Biochimie. 2011 May 7. [Epub ahead of print]

Reviews

Buy LASS6 monoclonal antibody (M01), clone 5H7 now

Add to cart