WDR27 monoclonal antibody (M01), clone 3C5 View larger

WDR27 monoclonal antibody (M01), clone 3C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR27 monoclonal antibody (M01), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about WDR27 monoclonal antibody (M01), clone 3C5

Brand: Abnova
Reference: H00253769-M01
Product name: WDR27 monoclonal antibody (M01), clone 3C5
Product description: Mouse monoclonal antibody raised against a full-length recombinant WDR27.
Clone: 3C5
Isotype: IgG1 Kappa
Gene id: 253769
Gene name: WDR27
Gene alias: MGC43690
Gene description: WD repeat domain 27
Genbank accession: BC040606.1
Immunogen: WDR27 (AAH40606.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MENPQDIFSSNGGCLSDIVIEKYLVESKESVSHVQLACSMQDCAFPLDGTELCIWNTKDPSHQLLILRGHHQPITAMAFGNKVNPLLICSASLDYVIMWNLDECREKVLQGLVPRGTVMGSLLGKVLCLQLSPDDHVVAVCAGNKIFMLDIEQRFSVTYIERPDVNNRHKVPPPTFLHTFSQAQAVRAELQGHLGPVTAVEFCPWRAGTLISASEDRGFKVWDHCTGSLIYSSSVLSAYPLLSLFIDAESRQLVTGVLTASFGSSV
Protein accession: AAH40606.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00253769-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00253769-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged WDR27 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy WDR27 monoclonal antibody (M01), clone 3C5 now

Add to cart