EBF3 monoclonal antibody (M06), clone 1G3 View larger

EBF3 monoclonal antibody (M06), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EBF3 monoclonal antibody (M06), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EBF3 monoclonal antibody (M06), clone 1G3

Brand: Abnova
Reference: H00253738-M06
Product name: EBF3 monoclonal antibody (M06), clone 1G3
Product description: Mouse monoclonal antibody raised against a partial recombinant EBF3.
Clone: 1G3
Isotype: IgG1 Kappa
Gene id: 253738
Gene name: EBF3
Gene alias: COE3|O/E-2
Gene description: early B-cell factor 3
Genbank accession: NM_001005463
Immunogen: EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
Protein accession: NP_001005463
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00253738-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00253738-M06-1-19-1.jpg
Application image note: EBF3 monoclonal antibody (M06), clone 1G3. Western Blot analysis of EBF3 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EBF3 monoclonal antibody (M06), clone 1G3 now

Add to cart