EBF3 monoclonal antibody (M05), clone 8D6 View larger

EBF3 monoclonal antibody (M05), clone 8D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EBF3 monoclonal antibody (M05), clone 8D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about EBF3 monoclonal antibody (M05), clone 8D6

Brand: Abnova
Reference: H00253738-M05
Product name: EBF3 monoclonal antibody (M05), clone 8D6
Product description: Mouse monoclonal antibody raised against a partial recombinant EBF3.
Clone: 8D6
Isotype: IgG1 Kappa
Gene id: 253738
Gene name: EBF3
Gene alias: COE3|O/E-2
Gene description: early B-cell factor 3
Genbank accession: NM_001005463
Immunogen: EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
Protein accession: NP_001005463
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00253738-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00253738-M05-1-19-1.jpg
Application image note: EBF3 monoclonal antibody (M05), clone 8D6 Western Blot analysis of EBF3 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Differential effects of a polyalanine tract expansion in Arx on neural development and gene expression.Nasrallah MP, Cho G, Putt ME, Kitamura K, Golden JA.
Hum Mol Genet. 2011 Dec 2.

Reviews

Buy EBF3 monoclonal antibody (M05), clone 8D6 now

Add to cart