Brand: | Abnova |
Reference: | H00253738-M05 |
Product name: | EBF3 monoclonal antibody (M05), clone 8D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EBF3. |
Clone: | 8D6 |
Isotype: | IgG1 Kappa |
Gene id: | 253738 |
Gene name: | EBF3 |
Gene alias: | COE3|O/E-2 |
Gene description: | early B-cell factor 3 |
Genbank accession: | NM_001005463 |
Immunogen: | EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS |
Protein accession: | NP_001005463 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | EBF3 monoclonal antibody (M05), clone 8D6 Western Blot analysis of EBF3 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Differential effects of a polyalanine tract expansion in Arx on neural development and gene expression.Nasrallah MP, Cho G, Putt ME, Kitamura K, Golden JA. Hum Mol Genet. 2011 Dec 2. |