RICTOR monoclonal antibody (M01A), clone 1F3 View larger

RICTOR monoclonal antibody (M01A), clone 1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RICTOR monoclonal antibody (M01A), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about RICTOR monoclonal antibody (M01A), clone 1F3

Brand: Abnova
Reference: H00253260-M01A
Product name: RICTOR monoclonal antibody (M01A), clone 1F3
Product description: Mouse monoclonal antibody raised against a partial recombinant RICTOR.
Clone: 1F3
Isotype: IgG2b Kappa
Gene id: 253260
Gene name: RICTOR
Gene alias: DKFZp686B11164|KIAA1999|MGC39830|mAVO3
Gene description: rapamycin-insensitive companion of mTOR
Genbank accession: NM_152756
Immunogen: RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
Protein accession: NP_689969
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00253260-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00253260-M01A-1-25-1.jpg
Application image note: RICTOR monoclonal antibody (M01A), clone 1F3 Western Blot analysis of RICTOR expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RICTOR monoclonal antibody (M01A), clone 1F3 now

Add to cart