H00253260-M01A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00253260-M01A |
Product name: | RICTOR monoclonal antibody (M01A), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RICTOR. |
Clone: | 1F3 |
Isotype: | IgG2b Kappa |
Gene id: | 253260 |
Gene name: | RICTOR |
Gene alias: | DKFZp686B11164|KIAA1999|MGC39830|mAVO3 |
Gene description: | rapamycin-insensitive companion of mTOR |
Genbank accession: | NM_152756 |
Immunogen: | RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE |
Protein accession: | NP_689969 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | RICTOR monoclonal antibody (M01A), clone 1F3 Western Blot analysis of RICTOR expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |