NEIL2 monoclonal antibody (M01), clone 1B7 View larger

NEIL2 monoclonal antibody (M01), clone 1B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEIL2 monoclonal antibody (M01), clone 1B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about NEIL2 monoclonal antibody (M01), clone 1B7

Brand: Abnova
Reference: H00252969-M01
Product name: NEIL2 monoclonal antibody (M01), clone 1B7
Product description: Mouse monoclonal antibody raised against a full length recombinant NEIL2.
Clone: 1B7
Isotype: IgG1 Kappa
Gene id: 252969
Gene name: NEIL2
Gene alias: FLJ31644|MGC2832|MGC4505|NEH2|NEI2
Gene description: nei like 2 (E. coli)
Genbank accession: BC013964
Immunogen: NEIL2 (AAH13964, 1 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Protein accession: AAH13964
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00252969-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (62.26 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00252969-M01-13-15-1.jpg
Application image note: Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 monoclonal antibody (M01), clone 1B7.

Lane 1: NEIL2 transfected lysate(36.8 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy NEIL2 monoclonal antibody (M01), clone 1B7 now

Add to cart