Cart 58 Product Products 16 037,40 € (empty)
No products
To be determined Shipping
16 037,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 58 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 037,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 037,40 €
Data sheet of NEIL2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about NEIL2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00252969-D01P |
| Product name: | NEIL2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NEIL2 protein. |
| Gene id: | 252969 |
| Gene name: | NEIL2 |
| Gene alias: | FLJ31644|MGC2832|MGC4505|NEH2|NEI2 |
| Gene description: | nei like 2 (E. coli) |
| Genbank accession: | NM_145043.1 |
| Immunogen: | NEIL2 (NP_659480.1, 1 a.a. ~ 332 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS |
| Protein accession: | NP_659480.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NEIL2 expression in transfected 293T cell line (H00252969-T02) by NEIL2 MaxPab polyclonal antibody. Lane 1: NEIL2 transfected lysate(36.80 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |