NEIL2 MaxPab mouse polyclonal antibody (B01) View larger

NEIL2 MaxPab mouse polyclonal antibody (B01)

H00252969-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEIL2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NEIL2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00252969-B01
Product name: NEIL2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NEIL2 protein.
Gene id: 252969
Gene name: NEIL2
Gene alias: FLJ31644|MGC2832|MGC4505|NEH2|NEI2
Gene description: nei like 2 (E. coli)
Genbank accession: NM_145043.1
Immunogen: NEIL2 (NP_659480.1, 1 a.a. ~ 332 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Protein accession: NP_659480.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00252969-B01-13-15-1.jpg
Application image note: Western Blot analysis of NEIL2 expression in transfected 293T cell line (H00252969-T01) by NEIL2 MaxPab polyclonal antibody.

Lane 1: NEIL2 transfected lysate(36.52 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NEIL2 MaxPab mouse polyclonal antibody (B01) now

Add to cart