ZNF396 monoclonal antibody (M01), clone 2F8 View larger

ZNF396 monoclonal antibody (M01), clone 2F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF396 monoclonal antibody (M01), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF396 monoclonal antibody (M01), clone 2F8

Brand: Abnova
Reference: H00252884-M01
Product name: ZNF396 monoclonal antibody (M01), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF396.
Clone: 2F8
Isotype: IgG2b Kappa
Gene id: 252884
Gene name: ZNF396
Gene alias: FLJ31213|ZSCAN14
Gene description: zinc finger protein 396
Genbank accession: NM_145756
Immunogen: ZNF396 (NP_665699.1, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERELDGPKQIFFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQSSTYRG
Protein accession: NP_665699.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00252884-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00252884-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF396 expression in transfected 293T cell line by ZNF396 monoclonal antibody (M01), clone 2F8.

Lane 1: ZNF396 transfected lysate(38.3 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF396 monoclonal antibody (M01), clone 2F8 now

Add to cart