IL27 monoclonal antibody (M03), clone 1A9 View larger

IL27 monoclonal antibody (M03), clone 1A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL27 monoclonal antibody (M03), clone 1A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL27 monoclonal antibody (M03), clone 1A9

Brand: Abnova
Reference: H00246778-M03
Product name: IL27 monoclonal antibody (M03), clone 1A9
Product description: Mouse monoclonal antibody raised against a partial recombinant IL27.
Clone: 1A9
Isotype: IgG1 Kappa
Gene id: 246778
Gene name: IL27
Gene alias: IL-27|IL-27A|IL27p28|IL30|MGC71873|p28
Gene description: interleukin 27
Genbank accession: NM_145659
Immunogen: IL27 (NP_663634, 177 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Protein accession: NP_663634
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00246778-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00246778-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IL27 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL27 monoclonal antibody (M03), clone 1A9 now

Add to cart