IL27 monoclonal antibody (M01), clone 3F12 View larger

IL27 monoclonal antibody (M01), clone 3F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL27 monoclonal antibody (M01), clone 3F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr,IP

More info about IL27 monoclonal antibody (M01), clone 3F12

Brand: Abnova
Reference: H00246778-M01
Product name: IL27 monoclonal antibody (M01), clone 3F12
Product description: Mouse monoclonal antibody raised against a partial recombinant IL27.
Clone: 3F12
Isotype: IgG1 Kappa
Gene id: 246778
Gene name: IL27
Gene alias: IL-27|IL-27A|IL27p28|IL30|MGC71873|p28
Gene description: interleukin 27
Genbank accession: NM_145659
Immunogen: IL27 (NP_663634, 177 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Protein accession: NP_663634
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00246778-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00246778-M01-1-1-1.jpg
Application image note: IL27 monoclonal antibody (M01), clone 3F12 Western Blot analysis of IL27 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy IL27 monoclonal antibody (M01), clone 3F12 now

Add to cart