Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00246721-M01 |
Product name: | POLR2J2 monoclonal antibody (M01), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant POLR2J2. |
Clone: | 1B2 |
Isotype: | IgG2a Kappa |
Gene id: | 246721 |
Gene name: | POLR2J2 |
Gene alias: | HRPB11B|MGC105050|MGC54043|RPB11b1 |
Gene description: | polymerase (RNA) II (DNA directed) polypeptide J2 |
Genbank accession: | NM_032959.3 |
Immunogen: | POLR2J2 (NP_116581.3, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP |
Protein accession: | NP_116581.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.5 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLR2J2 expression in transfected 293T cell line by POLR2J2 monoclonal antibody (M01), clone 1B2. Lane 1: POLR2J2 transfected lysate(12.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |