POLR2J2 monoclonal antibody (M01), clone 1B2 View larger

POLR2J2 monoclonal antibody (M01), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLR2J2 monoclonal antibody (M01), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about POLR2J2 monoclonal antibody (M01), clone 1B2

Brand: Abnova
Reference: H00246721-M01
Product name: POLR2J2 monoclonal antibody (M01), clone 1B2
Product description: Mouse monoclonal antibody raised against a full-length recombinant POLR2J2.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 246721
Gene name: POLR2J2
Gene alias: HRPB11B|MGC105050|MGC54043|RPB11b1
Gene description: polymerase (RNA) II (DNA directed) polypeptide J2
Genbank accession: NM_032959.3
Immunogen: POLR2J2 (NP_116581.3, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
Protein accession: NP_116581.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00246721-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00246721-M01-13-15-1.jpg
Application image note: Western Blot analysis of POLR2J2 expression in transfected 293T cell line by POLR2J2 monoclonal antibody (M01), clone 1B2.

Lane 1: POLR2J2 transfected lysate(12.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POLR2J2 monoclonal antibody (M01), clone 1B2 now

Add to cart