RNASEH1 monoclonal antibody (M01), clone 5D10 View larger

RNASEH1 monoclonal antibody (M01), clone 5D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNASEH1 monoclonal antibody (M01), clone 5D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about RNASEH1 monoclonal antibody (M01), clone 5D10

Brand: Abnova
Reference: H00246243-M01
Product name: RNASEH1 monoclonal antibody (M01), clone 5D10
Product description: Mouse monoclonal antibody raised against a partial recombinant RNASEH1.
Clone: 5D10
Isotype: IgG2a Kappa
Gene id: 246243
Gene name: RNASEH1
Gene alias: H1RNA
Gene description: ribonuclease H1
Genbank accession: NM_002936
Immunogen: RNASEH1 (NP_002927, 189 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Protein accession: NP_002927
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00246243-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00246243-M01-1-1-1.jpg
Application image note: RNASEH1 monoclonal antibody (M01), clone 5D10 Western Blot analysis of RNASEH1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNASEH1 monoclonal antibody (M01), clone 5D10 now

Add to cart