ATP6V1C2 monoclonal antibody (M01), clone 3D5 View larger

ATP6V1C2 monoclonal antibody (M01), clone 3D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V1C2 monoclonal antibody (M01), clone 3D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ATP6V1C2 monoclonal antibody (M01), clone 3D5

Brand: Abnova
Reference: H00245973-M01
Product name: ATP6V1C2 monoclonal antibody (M01), clone 3D5
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP6V1C2.
Clone: 3D5
Isotype: IgG2b Kappa
Gene id: 245973
Gene name: ATP6V1C2
Gene alias: ATP6C2|VMA5
Gene description: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
Genbank accession: NM_144583
Immunogen: ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD
Protein accession: NP_653184
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00245973-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00245973-M01-1-1-1.jpg
Application image note: ATP6V1C2 monoclonal antibody (M01), clone 3D5 Western Blot analysis of ATP6V1C2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP6V1C2 monoclonal antibody (M01), clone 3D5 now

Add to cart