ATP6V1C2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ATP6V1C2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V1C2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about ATP6V1C2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00245973-D01P
Product name: ATP6V1C2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ATP6V1C2 protein.
Gene id: 245973
Gene name: ATP6V1C2
Gene alias: ATP6C2|VMA5
Gene description: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
Genbank accession: BC012142.1
Immunogen: ATP6V1C2 (AAH12142.1, 1 a.a. ~ 381 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD
Protein accession: AAH12142.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00245973-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ATP6V1C2 expression in transfected 293T cell line (H00245973-T01) by ATP6V1C2 MaxPab polyclonal antibody.

Lane 1: ATP6V1C2 transfected lysate(43.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATP6V1C2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart