ATP6V0D2 monoclonal antibody (M01A), clone 7A4 View larger

ATP6V0D2 monoclonal antibody (M01A), clone 7A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V0D2 monoclonal antibody (M01A), clone 7A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ATP6V0D2 monoclonal antibody (M01A), clone 7A4

Brand: Abnova
Reference: H00245972-M01A
Product name: ATP6V0D2 monoclonal antibody (M01A), clone 7A4
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP6V0D2.
Clone: 7A4
Isotype: IgG2b Kappa
Gene id: 245972
Gene name: ATP6V0D2
Gene alias: ATP6D2|FLJ38708|VMA6
Gene description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Genbank accession: NM_152565
Immunogen: ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
Protein accession: NP_689778
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00245972-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP6V0D2 monoclonal antibody (M01A), clone 7A4 now

Add to cart