ATP6V0D2 monoclonal antibody (M01), clone 7A4 View larger

ATP6V0D2 monoclonal antibody (M01), clone 7A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V0D2 monoclonal antibody (M01), clone 7A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATP6V0D2 monoclonal antibody (M01), clone 7A4

Brand: Abnova
Reference: H00245972-M01
Product name: ATP6V0D2 monoclonal antibody (M01), clone 7A4
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP6V0D2.
Clone: 7A4
Isotype: IgG2b Kappa
Gene id: 245972
Gene name: ATP6V0D2
Gene alias: ATP6D2|FLJ38708|VMA6
Gene description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Genbank accession: NM_152565
Immunogen: ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
Protein accession: NP_689778
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00245972-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00245972-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Increased IL-6 expression in osteoclasts is necessary but not sufficient for the development of Paget's disease of bone.Teramachi J, Zhou H, Subler MA, Kitagawa Y, Galson DL, Dempster DW, Windle JJ, Kurihara N, Roodman GD
J Bone Miner Res. 2014 Jun;29(6):1456-65. doi: 10.1002/jbmr.2158.

Reviews

Buy ATP6V0D2 monoclonal antibody (M01), clone 7A4 now

Add to cart