Brand: | Abnova |
Reference: | H00245972-M01 |
Product name: | ATP6V0D2 monoclonal antibody (M01), clone 7A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V0D2. |
Clone: | 7A4 |
Isotype: | IgG2b Kappa |
Gene id: | 245972 |
Gene name: | ATP6V0D2 |
Gene alias: | ATP6D2|FLJ38708|VMA6 |
Gene description: | ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 |
Genbank accession: | NM_152565 |
Immunogen: | ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN |
Protein accession: | NP_689778 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Increased IL-6 expression in osteoclasts is necessary but not sufficient for the development of Paget's disease of bone.Teramachi J, Zhou H, Subler MA, Kitagawa Y, Galson DL, Dempster DW, Windle JJ, Kurihara N, Roodman GD J Bone Miner Res. 2014 Jun;29(6):1456-65. doi: 10.1002/jbmr.2158. |