Brand: | Abnova |
Reference: | H00245711-P01 |
Product name: | SPDYA (Human) Recombinant Protein (P01) |
Product description: | Human SPDYA full-length ORF ( NP_877433.2, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 245711 |
Gene name: | SPDYA |
Gene alias: | MGC110856|MGC57218|Ringo3|SPDY1|SPY1 |
Gene description: | speedy homolog A (Xenopus laevis) |
Genbank accession: | NM_182756.2 |
Immunogen sequence/protein sequence: | MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE |
Protein accession: | NP_877433.2 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Differential Immunogenicity and Clinical Relevance of Kidney Compartment Specific Antigens after Renal Transplantation.Li L, Sigdel TK, Vitalone M, Lee SH, Sarwal MM. J Proteome Res. 2010 Oct 5. [Epub ahead of print] |