SLC29A4 monoclonal antibody (M03), clone 6B6 View larger

SLC29A4 monoclonal antibody (M03), clone 6B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC29A4 monoclonal antibody (M03), clone 6B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SLC29A4 monoclonal antibody (M03), clone 6B6

Brand: Abnova
Reference: H00222962-M03
Product name: SLC29A4 monoclonal antibody (M03), clone 6B6
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC29A4.
Clone: 6B6
Isotype: IgG2a Kappa
Gene id: 222962
Gene name: SLC29A4
Gene alias: ENT4|FLJ34923|PMAT
Gene description: solute carrier family 29 (nucleoside transporters), member 4
Genbank accession: NM_153247
Immunogen: SLC29A4 (NP_694979, 283 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Protein accession: NP_694979
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00222962-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00222962-M03-1-11-1.jpg
Application image note: SLC29A4 monoclonal antibody (M03), clone 6B6 Western Blot analysis of SLC29A4 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC29A4 monoclonal antibody (M03), clone 6B6 now

Add to cart