SLC29A4 polyclonal antibody (A01) View larger

SLC29A4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC29A4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC29A4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00222962-A01
Product name: SLC29A4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC29A4.
Gene id: 222962
Gene name: SLC29A4
Gene alias: ENT4|FLJ34923|PMAT
Gene description: solute carrier family 29 (nucleoside transporters), member 4
Genbank accession: NM_153247
Immunogen: SLC29A4 (NP_694979, 283 a.a. ~ 345 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Protein accession: NP_694979
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00222962-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.04 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC29A4 polyclonal antibody (A01) now

Add to cart