SCUBE3 monoclonal antibody (M07), clone 1D6 View larger

SCUBE3 monoclonal antibody (M07), clone 1D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCUBE3 monoclonal antibody (M07), clone 1D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SCUBE3 monoclonal antibody (M07), clone 1D6

Brand: Abnova
Reference: H00222663-M07
Product name: SCUBE3 monoclonal antibody (M07), clone 1D6
Product description: Mouse monoclonal antibody raised against a partial recombinant SCUBE3.
Clone: 1D6
Isotype: IgG2a Kappa
Gene id: 222663
Gene name: SCUBE3
Gene alias: CEGF3|DKFZp686B09105|DKFZp686B1223|DKFZp686D20108|FLJ34743
Gene description: signal peptide, CUB domain, EGF-like 3
Genbank accession: BC052263
Immunogen: SCUBE3 (AAH52263.2, 29 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN
Protein accession: AAH52263.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00222663-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00222663-M07-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SCUBE3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCUBE3 monoclonal antibody (M07), clone 1D6 now

Add to cart