Brand: | Abnova |
Reference: | H00222256-M02 |
Product name: | FLJ23834 monoclonal antibody (M02), clone 1B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ23834. |
Clone: | 1B11 |
Isotype: | IgG1 Kappa |
Gene id: | 222256 |
Gene name: | FLJ23834 |
Gene alias: | FLJ43271|MGC133292|MGC133293 |
Gene description: | hypothetical protein FLJ23834 |
Genbank accession: | NM_152750 |
Immunogen: | FLJ23834 (NP_689963, 776 a.a. ~ 885 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK |
Protein accession: | NP_689963 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FLJ23834 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |