Cart 44 Product Products 14 060,69 € (empty)
No products
To be determined Shipping
14 060,69 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 44 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 060,69 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 060,69 €
Data sheet of JAZF1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about JAZF1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00221895-D01P |
| Product name: | JAZF1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human JAZF1 protein. |
| Gene id: | 221895 |
| Gene name: | JAZF1 |
| Gene alias: | DKFZp761K2222|TIP27|ZNF802 |
| Gene description: | JAZF zinc finger 1 |
| Genbank accession: | BC042441.1 |
| Immunogen: | JAZF1 (AAH42441.1, 1 a.a. ~ 243 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ |
| Protein accession: | AAH42441.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | JAZF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of JAZF1 expression in HeLa. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |