Brand: | Abnova |
Reference: | H00221823-M01 |
Product name: | PRPS1L1 monoclonal antibody (M01), clone 5E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPS1L1. |
Clone: | 5E10 |
Isotype: | IgG3 Kappa |
Gene id: | 221823 |
Gene name: | PRPS1L1 |
Gene alias: | PRPS1|PRPS3|PRPSL|PRS-III |
Gene description: | phosphoribosyl pyrophosphate synthetase 1-like 1 |
Genbank accession: | NM_175886 |
Immunogen: | PRPS1L1 (NP_787082, 146 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR |
Protein accession: | NP_787082 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | PRPS1L1 monoclonal antibody (M01), clone 5E10 Western Blot analysis of PRPS1L1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |