Brand: | Abnova |
Reference: | H00221264-M01 |
Product name: | C6orf199 monoclonal antibody (M01), clone 1H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C6orf199. |
Clone: | 1H8 |
Isotype: | IgG2a Kappa |
Gene id: | 221264 |
Gene name: | C6orf199 |
Gene alias: | FLJ42177|MGC26954|RP1-70A9.1|dJ70A9.1 |
Gene description: | chromosome 6 open reading frame 199 |
Genbank accession: | NM_145025 |
Immunogen: | C6orf199 (NP_659462, 321 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN |
Protein accession: | NP_659462 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to C6orf199 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |