LOC221143 MaxPab mouse polyclonal antibody (B03) View larger

LOC221143 MaxPab mouse polyclonal antibody (B03)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC221143 MaxPab mouse polyclonal antibody (B03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LOC221143 MaxPab mouse polyclonal antibody (B03)

Brand: Abnova
Reference: H00221143-B03
Product name: LOC221143 MaxPab mouse polyclonal antibody (B03)
Product description: Mouse polyclonal antibody raised against a full-length human LOC221143 protein.
Gene id: 221143
Gene name: N6AMT2
Gene alias: ESP13
Gene description: N-6 adenine-specific DNA methyltransferase 2 (putative)
Genbank accession: NM_174928
Immunogen: LOC221143 (NP_777588.1, 1 a.a. ~ 214 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI
Protein accession: NP_777588.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00221143-B03-13-15-1.jpg
Application image note: Western Blot analysis of N6AMT2 expression in transfected 293T cell line (H00221143-T01) by N6AMT2 MaxPab polyclonal antibody.

Lane 1: LOC221143 transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC221143 MaxPab mouse polyclonal antibody (B03) now

Add to cart