Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00220202-M02 |
Product name: | ATOH7 monoclonal antibody (M02), clone 1E5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ATOH7. |
Clone: | 1E5 |
Isotype: | IgG2a Kappa |
Gene id: | 220202 |
Gene name: | ATOH7 |
Gene alias: | Math5|bHLHa13 |
Gene description: | atonal homolog 7 (Drosophila) |
Genbank accession: | NM_145178 |
Immunogen: | ATOH7 (NP_660161, 53 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA |
Protein accession: | NP_660161 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (31.06 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ATOH7 expression in transfected 293T cell line by ATOH7 monoclonal antibody (M02), clone 1E5. Lane 1: ATOH7 transfected lysate(16.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |