Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATOH7 monoclonal antibody (M01), clone 1A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about ATOH7 monoclonal antibody (M01), clone 1A5
| Brand: | Abnova |
| Reference: | H00220202-M01 |
| Product name: | ATOH7 monoclonal antibody (M01), clone 1A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATOH7. |
| Clone: | 1A5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 220202 |
| Gene name: | ATOH7 |
| Gene alias: | Math5|bHLHa13 |
| Gene description: | atonal homolog 7 (Drosophila) |
| Genbank accession: | NM_145178 |
| Immunogen: | ATOH7 (NP_660161, 53 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA |
| Protein accession: | NP_660161 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.06 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ATOH7 expression in transfected 293T cell line by ATOH7 monoclonal antibody (M01), clone 1A5. Lane 1: ATOH7 transfected lysate(16.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | ATOH7 mutations cause autosomal recessive persistent hyperplasia of the primary vitreous.Prasov L, Masud T, Khaliq S, Mehdi SQ, Abid A, Oliver ER, Silva ED, Lewanda A, Brodsky MC, Borchert M, Kelberman D, Sowden JC, Dattani MT, Glaser T. Hum Mol Genet. 2012 Jun 8. |