Product description: | Mouse polyclonal antibody raised against a full-length human MGC35295 protein. |
Gene id: | 219995 |
Gene name: | MS4A15 |
Gene alias: | FLJ34527|MGC35295 |
Gene description: | membrane-spanning 4-domains, subfamily A, member 15 |
Genbank accession: | NM_152717 |
Immunogen: | MGC35295 (NP_689930, 1 a.a. ~ 147 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV |
Protein accession: | NP_689930 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Size: | 50 uL |
Shipping condition: | Dry Ice |