Brand: | Abnova |
Reference: | H00219970-M03 |
Product name: | GLYATL2 monoclonal antibody (M03), clone 1C5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GLYATL2. |
Clone: | 1C5 |
Isotype: | IgG1 Kappa |
Gene id: | 219970 |
Gene name: | GLYATL2 |
Gene alias: | BXMAS2-10|GATF-B|MGC24009 |
Gene description: | glycine-N-acyltransferase-like 2 |
Genbank accession: | BC016789.1 |
Immunogen: | GLYATL2 (AAH16789.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC |
Protein accession: | AAH16789.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (60.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GLYATL2 monoclonal antibody (M03), clone 1C5. Western Blot analysis of GLYATL2 expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |