RTKN2 purified MaxPab mouse polyclonal antibody (B01P) View larger

RTKN2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RTKN2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about RTKN2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00219790-B01P
Product name: RTKN2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RTKN2 protein.
Gene id: 219790
Gene name: RTKN2
Gene alias: DKFZp686J10120|PLEKHK1|bA531F24.1
Gene description: rhotekin 2
Genbank accession: BC025765
Immunogen: RTKN2 (AAH25765.1, 1 a.a. ~ 163 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL
Protein accession: AAH25765.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00219790-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RTKN2 expression in transfected 293T cell line (H00219790-T02) by RTKN2 MaxPab polyclonal antibody.

Lane 1: PLEKHK1 transfected lysate(17.93 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RTKN2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart