Brand: | Abnova |
Reference: | H00219699-M01 |
Product name: | UNC5B monoclonal antibody (M01), clone 1A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UNC5B. |
Clone: | 1A9 |
Isotype: | IgG1 kappa |
Gene id: | 219699 |
Gene name: | UNC5B |
Gene alias: | UNC5H2|p53RDL1 |
Gene description: | unc-5 homolog B (C. elegans) |
Genbank accession: | NM_170744 |
Immunogen: | UNC5B (NP_734465, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY |
Protein accession: | NP_734465 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UNC5B is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |